Augusta crime mugshots richmond county today archives.
Augusta crime mugshots richmond county today archives Mar 3, 2025 · An arrest does not mean that the detainee has been convicted of the crime. Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Feb 21, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Feb 14, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. 1 day ago · While every effort is made to ensure that the posted information is accurate, it may contain factual or other errors. Feb 20, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Records Per Page: 5 days ago · While every effort is made to ensure that the posted information is accurate, it may contain factual or other errors. Apr 11, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Constantly updated. Feb 27, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Apr 16, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Mar 27, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Apr 22, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Apr 9, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. 2 days ago · An archive of every person arrested and booked into the Richmond County Jail in Richmond County, Georgia. . Madison Lewis Jr. Richmond County. Mar 31, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. com is not affiliated or supported by any law enforcement or government department or agency. Feb 24, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Content is public domain and is compiled from public records. 5 days ago · Explore recent mugshots, arrests, and bookings in Augusta County, Virginia. Mar 21, 2025 · Crime Cloud. AugustaCrime. Arrest Date. Apr 17, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Stay informed about local law enforcement activities and access up-to-date booking information. Breaking news for Augusta, GA and CSRA. Detainee information changes quickly, and the posted information may not reflect the current information. Oct 15, 2021 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Apr 22, 2025 · An arrest does not mean that the detainee has been convicted of the crime. Alcohol (DUI) Assault. Nov 4, 2023 · Race/Sex/Age. , 21, and Kyadiar Oliver, 19, were both arrested on murder charges following the shooting death of 19-year-old Damien Patrick from Hephzibah on Wednesday. Apr 23, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Largest Database of Richmond County Mugshots. Apr 7, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. News. Sep 10, 2019 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Jan 23, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Apr 24, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. 3 days ago · Augusta Woman Claims She Was Raped by Man She Met Online April 22, 2025 New Report Shows Mother’s Threats to Jamestown Principal Ended in Standoff at Parent’s Home Apr 24, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Jan 16, 2024 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Jan 15, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Feb 9, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Feb 1, 2021 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Mar 25, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Apr 1, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. An arrest does not mean that the detainee has been convicted of the crime. Home Mugshots Richmond County. Includes Augusta, Blythe, Hephzibah, Fort Gordon, and all surrounding areas served by the Richmond County Sheriff’s Office. Find latests mugshots and bookings from Augusta and other local cities. Apr 12, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. The information on this website should not be relied upon for any type of legal action. Apr 6, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. com - Breaking news for Augusta, GA and CSRA. Feb 27, 2025 · Crime Cloud. Mar 3, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. Feb 7, 2025 · Richmond County authorities released the mugshots Thursday of two young men charged with the daylight killing of an Augusta man outside a Family Dollar store. Apr 14, 2025 · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. hcxsuejfycithsnfcylcavkhilvwpsrfdqinhkwhjmxuxigrcxjlezyuvnlmvifxjipuzqlcdvzchw